PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0093s0071.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 517aa    MW: 56706 Da    PI: 7.4617
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0093s0071.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.94.4e-33192248259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          dDgynWrKYGqK+vkgse+prsYY+Ct++gCp+kkkvers  d++++ei+Y+g+Hnh 
  Kalax.0093s0071.2.p 192 DDGYNWRKYGQKQVKGSENPRSYYKCTFPGCPTKKKVERSL-DGDITEIVYKGSHNHA 248
                          8****************************************.***************7 PP

2WRKY105.72.3e-33361419159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnh+
  Kalax.0093s0071.2.p 361 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDLRAVITTYEGKHNHD 419
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-29182250IPR003657WRKY domain
SuperFamilySSF1182901.44E-25185250IPR003657WRKY domain
PROSITE profilePS5081124.03186250IPR003657WRKY domain
SMARTSM007744.7E-36191249IPR003657WRKY domain
PfamPF031063.4E-25192247IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-37346421IPR003657WRKY domain
SuperFamilySSF1182902.62E-29353421IPR003657WRKY domain
PROSITE profilePS5081138.377356421IPR003657WRKY domain
SMARTSM007743.1E-39361420IPR003657WRKY domain
PfamPF031068.0E-26362419IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MAASSANSPF SLSPSFMNNS FSDLLNSPAA VAPGDDSTLL NGSVNRGAPK FKSLHPPSLL  60
PVSPTPASPS SYFAFPPGLS PSELLDSPVL LTSSYLLPSP TTGSFPAAQP HNWSVSGQHD  120
VKPEDSRNQN NTSSYSDFTF QPELRTVSQP WNFKSYQSQQ KTDSISNERV SGDYSSYQPA  180
PIQSVREARR SDDGYNWRKY GQKQVKGSEN PRSYYKCTFP GCPTKKKVER SLDGDITEIV  240
YKGSHNHAKP QSTRRSASNG SHPMQHVNGE LQAQEHSVGS QMVANQLSDH SAATPENSSV  300
SVGDDDRSSS RRVGDDKLDD DEPDHKRWKR ENEGEIMSAP GCRAVREPRV VVQTTSDIDI  360
LDDGYRWRKY GQKVVKGNPN PRSYYKCTNP GCPVRKHVER ASHDLRAVIT TYEGKHNHDV  420
PAARGSGSHS RQAAANNSCV TNSTHHQSST GQPATAQQAP FTLEMLHGPE SFGFGNPVSA  480
YNNVNGRQQN PDCSVFPRTK EEPREDQFLE SICYAD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37182422878Probable WRKY transcription factor 4
2lex_A1e-37182422878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0539942e-54BT053994.1 Zea mays full-length cDNA clone ZM_BFc0103O21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142085.11e-172hypothetical protein PHAVU_008G251300g
SwissprotQ8S8P51e-110WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLV7B8C11e-172V7B8C1_PHAVU; Uncharacterized protein
STRINGGLYMA14G38010.11e-167(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-101WRKY DNA-binding protein 33